<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-81995 EHR-81995 Spain 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, I64L, H69K, V82I, L89M  
>EHR-81995| codons 4-99
TLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
LEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, V60I, A98S, S162A, K173V, Q174K, D177E, T200A, Q207E, R211K, V245E L80LP
>EHR-81995| codons 30-247
QIGCTLNFCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFREPNKRTQDFWE
VQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQASMTKILEPFRVKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013