<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-79741 EHR-79741 Spain 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I K20R, M36I, N37T, R41K, L63P, I93L  
>EHR-79741| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVIEEITLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K43KR, A158S, E169D, Q207K, R211A, F214L, V245E G152GE
>EHR-79741| codons 41-247
MEREGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQEWKGSPSIF
QSSMTKILDPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRKHLLAWGLTTPDKK
HQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013