<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-77855 EHR-77855 Czech Republic 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, E36D, T39K, E40D, S68G, K122E, D123S, I135T, T165I, K173L, Q174K, D177E, V179I, Q207A, R211S, F214L, V245M  
>EHR-77855| codons 1-247
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTDICKDMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRLKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, R41K, H69K, K70KT, L89M, I93IL, F99FL  
>EHR-77855| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKTAIGTVLVGPTPVNIIGRNMLTQLGCTLNL

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013