<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF-11 JF11-M5 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 NRTI+ IDV NA
3 DDI+ D4T+ NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V35I, E44D, K122E, D177E, I178M, G196E, T200K, K201R, H208Y, R211K, V245M P226A
>JF11-M5| codons 26-256
LTEEKIKALIEICTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQ
DFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQ
YNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIEQHRKRIEEL
RQYLWKWGFYTPDKKHQKEPAFLWMGYELHPDKWTVQPIMLPEKDSWTVND

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, I62V, L63C, T74S, V77I  
>JF11-M5| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QVCIEICGHKAIGSVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Fitzgibbon, JE Emergence of drug resistance mutations in a group of HIV-infected children taking nelfinavir-containing regimens. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005