<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF-10 JF10-M8 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T+3TC+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I15V, M36I, R41K, L63P, H69Q  
>JF10-M8| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K22N, K43N, K122E, D123E, A158S, R211K  
>JF10-M8| codons 14-249
PGMDGPKVNQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPVFAIKKKDSTKWRK
LVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIP
SINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDL
EIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEK

References
Author Title Citation
Fitzgibbon, JE Emergence of drug resistance mutations in a group of HIV-infected children taking nelfinavir-containing regimens. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005