<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-75605 EHR-75605 Austria 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15IV, G17E, K20I, M36I, L63T, I64M, H69K, L89M P39M
>EHR-75605| codons 1-99
PQITLWQRPLVTVKVGEQLIEALLDTGADDTVLEEINLMGRWKPKMIGGIGGFIKVRQYD
QITMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   K32KR, V35T, E36D, T39A, K49R, T69S, I135V, Q145E, K173I, Q174K, T200A, Q207E, R211K, F214L, H221HY, V245Q  
>EHR-75605| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTDICAEMEKEGKISRIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYEYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013