<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-75565 EHR-75565 Denmark 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I15V, G16E, M36I, R41K, D60E, I62V, L63T, I64V, I72T  
>EHR-75565| codons 1-99
PQITLWQRPLVAIKVEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QVTVEICGHKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D121Y, K122E, E169EK, D177E, E194EK, T200KR, Q207G, R211K, V245E  
>EHR-75565| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFRKQNPEIVI
YQYMDDLYVGSDLKIGQHRRKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013