<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-747144 EHR-747144 Austria 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36L, N37NS, R41K, L63LV, H69K, K70R, L89I, I93L I66IT
>EHR-747144| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYD
QIVIETCGKRAIGTVLVGPTPVNIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35IT, T39E, S48T, W88C, K122E, D123S, S162A, K173T, D177E, G196E, T200A, Q207N, R211K, F214L, V245Q  
>EHR-747144| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELRNHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013