<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF-6 JF6-B U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     V35M, K103R, K122E, D123E, A158S, N175Y, T200E  
>JF6-B| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQYPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLRWGFFTPDQKHQKEPPFLWMGYEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, M36I, I62V, L63P  
>JF6-B| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Fitzgibbon, JE Emergence of drug resistance mutations in a group of HIV-infected children taking nelfinavir-containing regimens. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005