<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-71598 EHR-71598 Romania 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, G16E, K20R, E35D, M36I, P39T, R41K, L63T, E65D, I72T, L89M  
>EHR-71598| codons 1-99
PQITLWQRPVVTVKVEGQLREALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVRQYD
QITIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, T39A, E40D, D123E, T139K, K173T, Q174K, I195L, T200A, Q207A, R211K, V245Q N137K, P140S, Y146K, L149I
>EHR-71598| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINKEKSGIRYQKNVIPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLELGQHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013