<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF-2 JF2-B U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V35I, K49R, P52A, R83K, K103R, I135T, S162C, R211K, V245E  
>JF2-B| codons 23-258
QWPLTEEKIKALIEICTELEKEGKISRIGAENPYNTPVFAIKKKNSTKWRKLVDFRELNK
KTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGI
RYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKI
EELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, L63P, H69Q, V77I  
>JF2-B| codons 1-99
PQITLWQRPLVIIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Fitzgibbon, JE Emergence of drug resistance mutations in a group of HIV-infected children taking nelfinavir-containing regimens. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005