Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JF-1 | JF1-M12 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+ 3TC | NA |
| 3 | D4T+ DDI+ NVP | NA |
| 4 | DDC+ NVP+ NFV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N, L90M | N88D | I13V, E35D, M36I, N37S, R57K, I62V, L63P, A71V, V77I |
| >JF1-M12| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDISLPGRWKPKMIGGIGGFIKVKQYD QVPIEICGHKVIGTVLIGPTPVNIIGRDLMTQIGCTLNF |
References
| Author | Title | Citation |
| Fitzgibbon, JE | Emergence of drug resistance mutations in a group of HIV-infected children taking nelfinavir-containing regimens. | ARHR, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |