<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JF-1 JF1-M4 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ 3TC NA
3 D4T+ DDI+ NVP NA
4 DDC+ NVP+ NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D M36I, N37S, R57K, L63P  
>JF1-M4| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEISLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   K103N, Y181C   K22N, V35T, T39A, R83K, A98S, K122E, I178L, R211K, V245E  
>JF1-M4| codons 14-249
PGMDGPKVNQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRK
VVDFRELNKKTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIP
SINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVICQYMDDLYVGSDL
EIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEK

References
Author Title Citation
Fitzgibbon, JE Emergence of drug resistance mutations in a group of HIV-infected children taking nelfinavir-containing regimens. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005