<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-65902 EHR-65902 Luxembourg 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, I62V, L63I, H69K, T74A, V82I, L89M, I93L  
>EHR-65902| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVIIEICGKKAIGAVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215S, K219E     V35T, E36A, T39E, V60I, S68G, A98S, K122E, D123S, I135T, K173T, Q174K, D177E, T200A, Q207E, R211K, V245Q  
>EHR-65902| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPI
FAIKKKNGTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFSTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013