<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-65498 EHR-65498 Ireland 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, E35D, M36I, R41K, L63A, H69K, L89M  
>EHR-65498| codons 4-99
TLWQRPLVTAKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIA
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39TS, E44EG, S48SFL, I135V, Q145QH, N147NK, S162A, K173I, Q174K, D177E, I178V, T200A, I202V, R211K, P243T, V245K I50IKMN, K126KN, V148VL, Q151Q*
>EHR-65498| codons 30-247
QIGCTLNFCSEMEKGGKILKNGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRNYTAFTIPSVNNETPGIRYHYKLL
P*GWKGSPAIFQASMTKILEPFRIKNPEVVIYQYMDDLYVGSDLEIGQHRAKVEELRQHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQTIKLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013