<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3636 P3636-2284 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ NVP+ D4T 7
2 3TC+ AZT+ RTV+ SQV 58
3 3TC+ AZT 19

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M L23I, G73T L10I, T12E, L19I, M36I, I62V, L63P, I93L R87K
>P3636-2284| codons 1-99
PQITLWQRPIVEIKIGGQIKEAILDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAITTVLVGPTPVNIIGKNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003