Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-3636 | P3636-2284 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NFV+ NVP+ D4T | 7 |
| 2 | 3TC+ AZT+ RTV+ SQV | 58 |
| 3 | 3TC+ AZT | 19 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, L90M | L23I, G73T | L10I, T12E, L19I, M36I, I62V, L63P, I93L | R87K |
| >P3636-2284| codons 1-99 PQITLWQRPIVEIKIGGQIKEAILDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVRQYD QVPIEICGHKAITTVLVGPTPVNIIGKNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |