Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-0233 | P0233-2920 | U.S. | 2000 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDI+ EFV+ NFV | 12 |
| 2 | NFV | 9 |
| 3 | ABC+ APV+ D4T | 38 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I47V, I54V, V82T, L90M | L10V, K20R, M36I, L63P, A71V, I72V, I93L |
| >P0233-2920| codons 1-99 PQITLWQRPVVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKIVGGIGGFVKVRQYD QIPIEICGHKVVGTVLVGPTPTNIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |