Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-8627 | P8627-3247 | U.S. | 2000 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | DDC | 7 |
| 2 | NRTI | 47 |
| 3 | 3TC+ AZT | 81 |
| 4 | NFV+ NVP+ D4T | 37 |
| 5 | Unknown | 69 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, I47V, V82A | L10I, G16A, E35D, M36I, L63P, I93L |
| >P8627-3247| codons 1-99 PQITLWQRPIVTIKIAGQLKEALLDTGADDTILEDINLPGRWKPKMVGGIGGFIKVRQYD QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |