<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-8627 P8627-3247 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 7
2 NRTI 47
3 3TC+ AZT 81
4 NFV+ NVP+ D4T 37
5 Unknown 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, V82A   L10I, G16A, E35D, M36I, L63P, I93L  
>P8627-3247| codons 1-99
PQITLWQRPIVTIKIAGQLKEALLDTGADDTILEDINLPGRWKPKMVGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003