<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-8546 P8546-3822 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 237
2 AZT+ DDC 55
3 3TC+ AZT 21
4 3TC+ AZT+ DDC 19
5 3TC+ AZT 13
6 3TC+ IDV+ D4T 27
7 IDV+ D4T 50
8 3TC+ D4T 97
9 APV+ RTV+ D4T 37
10 D4T+RTV 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I47V, I54M L33F, G73C L10LV, R57K, L63P  
>P8546-3822| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIVGGIGGFMKVKQYD
QIPIEICGHKAICTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003