<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-3714 P3714-2633 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 8
2 AZT+ 3TC+ RTV 10
3 AZT+ 3TC+ RTV+ IDV 34
4 3TC+ RTV+ IDV+ SQV+ D4T 15
5 RTV+ IDV+ SQV+ D4T 15
6 DDI+ NFV+ NVP+ IDV 18
7 3TC+ AZT+ IDV 3
8 3TC+ SQV+ D4T 44
9 EFV+ NFV+ DDI 28
10 ABC+ APV+ D4T 4
11 3TC+ APV+ D4T 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V, I54V, L90M G73T, L89V L10I, K20R, E35D, M36I, L63P, H69K, A71I, I93L  
>P3714-2633| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGVGGFVKVRQYD
QIPIEICGKKIITTVLVGPTPVNIIGRNVMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003