Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-3714 | P3714-2633 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+ AZT | 8 |
| 2 | AZT+ 3TC+ RTV | 10 |
| 3 | AZT+ 3TC+ RTV+ IDV | 34 |
| 4 | 3TC+ RTV+ IDV+ SQV+ D4T | 15 |
| 5 | RTV+ IDV+ SQV+ D4T | 15 |
| 6 | DDI+ NFV+ NVP+ IDV | 18 |
| 7 | 3TC+ AZT+ IDV | 3 |
| 8 | 3TC+ SQV+ D4T | 44 |
| 9 | EFV+ NFV+ DDI | 28 |
| 10 | ABC+ APV+ D4T | 4 |
| 11 | 3TC+ APV+ D4T | 15 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I50V, I54V, L90M | G73T, L89V | L10I, K20R, E35D, M36I, L63P, H69K, A71I, I93L |
| >P3714-2633| codons 1-99 PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGVGGFVKVRQYD QIPIEICGKKIITTVLVGPTPVNIIGRNVMTQLGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |