Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-2909 | P2909-2451 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+ AZT | 11 |
| 2 | 3TC+ AZT+ IDV | 80 |
| 3 | 3TC+ AZT+ NFV | 29 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| D30N | I13V, L63P, I64V, V75I |
| >P2909-2451| codons 1-99 PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD QIPVEICGHKAIGTILVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |