<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-59489 EHR-59489 Spain 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36L, N37T, I62V, L63S, I64V  
>EHR-59489| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEELTLPGRWKPKMIGGIGGFIKVRQYDQVS
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, K49R, D123E, I135T, T165TI, E169ED, G196E, R211K, V245M  
>EHR-59489| codons 30-247
QIGCTLNFCTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMIKILDPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013