<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-58400 EHR-58400 Belgium 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, M36I, N37K, R41NS, H69K, L89M  
>EHR-58400| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEIKLPGSWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V21I, V35T, T39DN, E40X, K104KR, K122E, D123G, I132IV, S134SN, I135IT, K166KR, K173T, D177E, T200A, Q207E, V245Q  
>EHR-58400| codons 1-247
PISPIETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICNXMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEGFRKYTAFTVPNTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013