<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-58182 EHR-58182 Slovenia 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I R41K, I62V, L63PS, I64IV, I72M, V77I, I85V  
>EHR-58182| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVSVEICGHKAMGTVLIGPTPVNIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        D123E, G196E, Q197K, R211K, V245E  
>EHR-58182| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEKHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013