<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-57646 EHR-57646 Finland 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, Q61N, L63C, H69Q  
>EHR-57646| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NICIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35T, K49R, V60I, D121C, K122E, A158S, E169D, D177E, G196E, T200A, E204N, Q207E, R211K, F214L, K238R, V245I  
>EHR-57646| codons 1-247
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRAKIENLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIILP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013