<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-57338 EHR-57338 Romania 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72T, T74S, L89M  
>EHR-57338| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, D121HY, K122E, D123E, I135L, S162H, K173T, Q174N, D177G, T200A, Q207K, R211K, F214L, V245Q  
>EHR-57338| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRTNNPGIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013