<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-54829 EHR-54829 Latvia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     T39K, V60VI, S68R, K103R, K104N, S105A, K122E, A158S, K173L, Q174K, T200TA, Q207A, R211S, V245VM L80A, Q85A, P95A, Y115YC
>EHR-54829| codons 38-247
CKEMEKEGKISKIGPENPYNTPIFVIKKKDRTKWRKLVDFREANKRTADFWEVQLGIAHP
AGLKKRNAVTVLDVGDACFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRLKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, I13IV, K14R, E35D, M36I, R41K, L63LP, C67X, H69KR, V77VI, L89M, I93L  
>EHR-54829| codons 4-99
TLWQRPIVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEIXGRKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013