<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-54354 EHR-54354 Germany 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L33F L10I, I13V, G16E, K43KR, I62V, L63S, A71T, V75I, I93L  
>EHR-54354| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVFEEMNLPGRWRPKMIGGIGGFIKVRQYD
QVSIEICGHKTIGTILVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K219Q     V35I, V90I, D123E, S162C, D177E, I195L, G196E, T200TI, I202V, E204EG, F214L, L228LF, V245E  
>EHR-54354| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLELEQHRIKVEGLRQHLLRWGLTTPDQKHQKEPPFFWMGYELHPDKWT
VQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013