<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-49324 EHR-49324 Cyprus 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11A, V35T, E36D, T39N, E40D, V60I, K122E, D123S, I135T, K173L, Q174K, D177E, T200TI, Q207AT, R211S, V245IK  
>EHR-49324| codons 1-247
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALTDICNDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRTHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013