<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-46864 EHR-46864 Sweden 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11A, V35I, E36EG, T39E, S68G, T69S, D121DE, K122E, D123S, K166KR, K173IL, Q174K, D177E, I178M, T200M, Q207A, R211S, V245E  
>EHR-46864| codons 1-247
PISPIDTVPVALKPGMDGPKVKQWPLTEEKIKALIGICEEMEKEGKISKIGPENPYNTPV
FAIKKKDGSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
EESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRLKNPEMVI
YQYMDDLYVGSDLEIGQHRMKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, E35D, M36I, R41K, H69K, K70R, I72IV, L89M  
>EHR-46864| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013