<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-46486 EHR-46486 Sweden 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, N37S, R41K, K43R, L63I, I64M, H69K, K70R, L89M, I93L  
>EHR-46486| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEISLPGKWRPKMIGGIGGFIKVRQYD
QIIMEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39TI, V60I, K104KR, I135V, S162A, K173T, Q174K, D177E, T200A, Q207E, R211RK, V245Q, L246M  
>EHR-46486| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICIEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQMP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013