<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-45704 EHR-45704 Ireland 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12TK, I13V, I15V, K20I, E35D, M36I, R41K, L63LV, H69K, V82I, L89M, I93IV G68GA, L97L*
>EHR-45704| codons 4-99
TLWQRPIVKVKVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIV
IEICAKKAIGTVLVGPTPINIIGRNMLTQVGCT*NF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E36K, I37F, K122E, I135T, K173KR, Q174QK, R211Q, F214L, V245E P157PL
>EHR-45704| codons 36-247
KFCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SLAIFQSSMTKILEPFRRKNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLQWGLT
TPDKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013