<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12TK, I13V, I15V, K20I, E35D, M36I, R41K, L63LV, H69K, V82I, L89M, I93IV G68GA, L97L*
>EHR-45704| codons 4-99
TLWQRPIVKVKVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIV
IEICAKKAIGTVLVGPTPINIIGRNMLTQVGCT*NF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E36K, I37F, K122E, I135T, K173KR, Q174QK, R211Q, F214L, V245E P157PL
>EHR-45704| codons 36-247
KFCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SLAIFQSSMTKILEPFRRKNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLQWGLT
TPDKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013