<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-45609 EHR-45609 Croatia 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L33V, N37NS, R41K, L63HQ, I64V  
>EHR-45609| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADDTVVEEMSLPGKWKPKMIGGIGGFIKVRQYDQIQ
VEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, E40D, K49KR, V60VI, D121H, K122E, I135IT, K173L, Q174K, D177E, T200TA, Q207E, R211K, V245KQ  
>EHR-45609| codons 30-247
QIGCTLNFCTDMEKEGKISRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILEPFRLKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013