<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-41487 EHR-41487 Romania 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20KR, E35D, M36I, R41K, I62IV, L63T, I64ILM, E65D, I72IT, V82VI, L89M  
>EHR-41487| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVTMDICGHKATGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K20R, V35T, T39A, E40ED, D123E, I135L, S162H, K166KR, K173AITV, Q174KR, N175Y, T200AE, Q207T, R211T, I244IMV, V245Q  
>EHR-41487| codons 1-247
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTRILEPFRVRYPDIDI
YQYMDDLYVGSDLEIGQHREKIEELRTHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013