<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-41332 EHR-41332 Croatia 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, K20T, M36T, R41K, L63V, H69K, V82I, I93L  
>EHR-41332| codons 4-99
TLWQRPLVTIKVGGQTTEALLDTGADDTVLEETNLPGKWKPKMIGGIGGFIKVRQYDQIV
IEICGKKAIGTVLVGPTPINIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35L, E36N, I37F, T39E, E40D, S48T, V60I, K122E, D123G, K173A, D177E, I178M, T200TA, E204K, Q207QE, R211KQ, V245Q  
>EHR-41332| codons 35-247
LNFCEDMEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
GSPAIFQSSMTKILEPFRAQNPEMVIYQYMDDLYVGSDLEIGQHRAKIEKLREHLLQWGF
TTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013