<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-39038 EHR-39038 Austria 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, I15V, K20R, E35D, M36I, R41K, R57K, Q61H, L63T, E65D, L89M  
>EHR-39038| codons 1-99
PQITLWQRPVVTVRVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
HITIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D123E, I135L, E138EA, I142IT, S162H, Q174K, T200E, Q207D, R211K, V245Q  
>EHR-39038| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNATPGTRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKKNPDIVI
YQYMDDLYVGSDLEIGQHREKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013