<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-36060 EHR-36060 Sweden 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35K, M36I, N37D, R41K, H69K, L89M  
>EHR-36060| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEKIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39TK, K49KR, K122E, I135L, S162A, K173T, D177E, T200E, E203Q, Q207E, R211RK, V245K  
>EHR-36060| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICKEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHREKIQELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013