<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-34005 EHR-34005 Sweden 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, I13V, G16E, E35D, M36I, R41K, H69K, K70R, I72V, L89M, I93V  
>EHR-34005| codons 1-99
PQITLWQRPMVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAVGTVLVGPTPVNIIGRNMLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, K49R, K122E, D123NS, T139V, S162SN, K173M, Q174K, D177E, I202V, Q207A, R211RK, K238R, V245E  
>EHR-34005| codons 1-247
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNEVPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRMKNPEIVI
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013