<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-27715 EHR-27715 Romania 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12AE, G16E, E35D, M36I, R41K, R57K, L63T, E65D, I72T, V77I, L89M, I93L  
>EHR-27715| codons 1-99
PQITLWQRPIVEIKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKATGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32I, V35T, V60I, V118VI, D123E, I135T, E138A, I142IV, S162C, K173A, Q174K, D177E, V189I, I195L, T200A, I202V, Q207A, R211K, V245Q  
>EHR-27715| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYIGSDLELGQHRAKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013