<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-27005 EHR-27005 Czech Republic 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I13V, N37C, R41K, L63S, I64V, H69Y, V77I  
>EHR-27005| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVIEEMCLPGKWKPKMIGGIGGFIKVRQYD
QISVEICGYKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, K101R, D123E, K166KR, D177DN, T200I, R211K, F214L, V245K  
>EHR-27005| codons 1-247
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPNIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013