<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-19532 EHR-19532 Denmark 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, K45R, R57K, L63S, H69K, L89M, F99L  
>EHR-19532| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11A, V35T, T39K, K43E, V60I, D121DE, K122E, D123S, K173T, Q174K, T200I, Q207D, K238R, V245E  
>EHR-19532| codons 1-247
PISPIDTVPVALKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
EESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013