<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-19066 EHR-19066 Ireland 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13V, K14R, K20I, M36L, N37S, R41K, L63P, H69K, L89I  
>EHR-19066| codons 4-99
TLWQRPLITVRIGGQLIEALLDTGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, D123E, I135V, S162A, K173T, Q174R, D177E, I178M, T200E, E203Q, Q207E, V245K  
>EHR-19066| codons 30-247
QIGCTLNFCTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVL
PQGWKGSPAIFQASMTKILEPFRTRNPEMVIYQYMDDLYVGSDLEIGQHREKIQELREHL
LRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013