<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-14086 EHR-14086 Germany 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, I50V, V118I, K122E, D123DN, I135T, I142IT, T165I, K173S, Q174QR, V179VI, E194ED, T200TA, Q207A, R211S, F214L, V245L  
>EHR-14086| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMIKILEPFRSRNPDIII
YQYMDDLYVGSDLDIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19I, E35D, M36I, R41K, R57K, D60E, I62IV, H69K, L89M  
>EHR-14086| codons 1-99
PQITLWQRPLVTVKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013