<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-13657 EHR-13657 Czech Republic 2007 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32I, V35T, T39K, V60I, K64KR, V118I, K122P, E138A, I142V, T165TI, K173A, D177E, T200A, I202V, E204D, Q207K, R211K, F214L, V245Q  
>EHR-13657| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALTEICKEMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEDLRKHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, L33V, E35N, M36I, R41K, D60E, L63P, H69K, T74S, L89M  
>EHR-13657| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVVENINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013