<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-12976 EHR-12976 Romania 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, S68G, D123E, I135T, I142V, S162H, K173V, Q174K, D177E, E194D, I195L, G196E, T200A, Q207A, V245Q  
>EHR-12976| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQHSMTKILEPFRVKNPEIVI
YQYMDDLYVGSDLDLEQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14S, I15V, K20R, E35D, M36I, R57K, I62V, L63T, E65D, K70KR, L89M  
>EHR-12976| codons 1-99
PQITLWQRPLVTISVGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVTIDICGHRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013