<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NFV+ RTI 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   I13V, E35D, M36L, I62V, L63P, A71T  
>DK-5723| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDLNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     P14PL, D123E, A158S, S162A, I178L, R211K, R284K, T286A, E297K, S322T, Q334E, M357T, A360T, A376S, T377M  
>DK-5723| codons 1-400
PISPIETVPVKLKLGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTRGT
HTNDVKQLTEAVQKISMESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003