<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-10411 EHR-10411 Latvia 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     T39K, K82R, K102Q, K122E, D123S, A158S, K173L, Q174K, D177G, T200A, Q207A, R211S, V245M I37L
>EHR-10411| codons 37-247
LCKEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPH
PAGLKQKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGS
PSIFQSSMTKILEPFRLKNPGIVIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, H69K, K70KE, V77I, L89M, I93L  
>EHR-10411| codons 4-99
TLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKEAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013