<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DK-5394 DK-5394 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ RTI 56
2 NFV+ RTI 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   L10R, L63P, A71T, I72T, V77VI, I93IL  
>DK-5394| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKTTGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       E28ED, T39A, K49R, K122E, D123N, I135T, I142V, S251I, I257L, A272P, Q278QH, T286TA, E297A F130FC, R143RI, N147NT
>DK-5394| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTDEKIKALVEICAELEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTACTIPSTNNETPGVIYQYTVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDIWTVNDLQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001