<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-06159 EHR-06159 Spain 2007 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, K45R, I64L, H69K, A71V, V82I, L89M, I93L  
>EHR-06159| codons 4-99
TLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYDQIL
LEICGKKVIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35L, E36N, I37F, V60I, I135V, S162A, K173V, Q174K, D177EG, T200A, Q207E, R211K  
>EHR-06159| codons 35-244
LNFCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWK
GSPAIFQASMTKILEPFRVKNPGIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGF
TTPDKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013