<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EHR-036308 EHR-036308 Belgium 2006 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12K, I13V, G16E, K20I, M36I, R41K, K43R, H69K, K70R, L89M  
>EHR-036308| codons 1-99
PQITLWQRPVVKVKIEGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4S, V35T, D123E, T165I, E169ED, K173AT, Q174K, D177E, I178M, T200A, I202V, Q207E, R211K, P243T, V245Q  
>EHR-036308| codons 1-247
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILDPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLP

References
Author Title Citation
Frentz, D Limited cross-border infections in patients newly diagnosed with HIV in Europe. Retrovirology, 2013